Lineage for d6legb2 (6leg B:182-273)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373157Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2373194Domain d6legb2: 6leg B:182-273 [399577]
    Other proteins in same PDB: d6lega1, d6lega3, d6lega4, d6legb1, d6legb3, d6legb4, d6legc1, d6legc3, d6legc4, d6legd1, d6legd3, d6legd4
    automated match to d3lpfa2
    complexed with sj5

Details for d6legb2

PDB Entry: 6leg (more details), 2.6 Å

PDB Description: structure of e. coli beta-glucuronidase complex with uronic isofagomine
PDB Compounds: (B:) Beta-D-glucuronidase

SCOPe Domain Sequences for d6legb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6legb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d6legb2:

Click to download the PDB-style file with coordinates for d6legb2.
(The format of our PDB-style files is described here.)

Timeline for d6legb2: