Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
Domain d6legb2: 6leg B:182-273 [399577] Other proteins in same PDB: d6lega1, d6lega3, d6lega4, d6legb1, d6legb3, d6legb4, d6legc1, d6legc3, d6legc4, d6legd1, d6legd3, d6legd4 automated match to d3lpfa2 complexed with sj5 |
PDB Entry: 6leg (more details), 2.6 Å
SCOPe Domain Sequences for d6legb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6legb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]} twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl wqpgegylyelcvtaksqtecdiyplrvgirs
Timeline for d6legb2: