Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (22 PDB entries) |
Domain d6lbig_: 6lbi G: [399515] automated match to d2mbfa_ protein/DNA complex |
PDB Entry: 6lbi (more details), 3.07 Å
SCOPe Domain Sequences for d6lbig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lbig_ a.4.5.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nawgnlsyadlitkaiessaekrltlsqiyewmvksvpyfkdkgdsnssagwknsirhnl slhskfirvqnegtgksswwmln
Timeline for d6lbig_: