Lineage for d1ebua2 (1ebu A:151-340)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527500Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 2527501Protein Homoserine dehydrogenase [55364] (1 species)
  7. 2527502Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55365] (4 PDB entries)
    Uniprot P31116
  8. 2527503Domain d1ebua2: 1ebu A:151-340 [39950]
    Other proteins in same PDB: d1ebua1, d1ebub1, d1ebuc1, d1ebud1
    complexed with hse, na, nda

Details for d1ebua2

PDB Entry: 1ebu (more details), 2.6 Å

PDB Description: homoserine dehydrogenase complex with nad analogue and l-homoserine
PDB Compounds: (A:) homoserine dehydrogenase

SCOPe Domain Sequences for d1ebua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebua2 d.81.1.2 (A:151-340) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piisflreiiqtgdevekiegifsgtlsyifnefstsqandvkfsdvvkvakklgytepd
prddlngldvarkvtivgrisgvevesptsfpvqslipkplesvksadefleklsdydkd
ltqlkkeaatenkvlrfigkvdvatksvsvgiekydyshpfaslkgsdnvisiktkrytn
pvviqgagag

SCOPe Domain Coordinates for d1ebua2:

Click to download the PDB-style file with coordinates for d1ebua2.
(The format of our PDB-style files is described here.)

Timeline for d1ebua2: