PDB entry 1ebu

View 1ebu on RCSB PDB site
Description: homoserine dehydrogenase complex with nad analogue and l-homoserine
Class: oxidoreductase
Keywords: homoserine, dehydrogenase, dinucleotide, ternary, analogue, OXIDOREDUCTASE
Deposited on 2000-01-24, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HOM6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebua1, d1ebua2
  • Chain 'B':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HOM6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebub1, d1ebub2
  • Chain 'C':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HOM6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebuc1, d1ebuc2
  • Chain 'D':
    Compound: homoserine dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HOM6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ebud1, d1ebud2
  • Heterogens: NA, NDA, HSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebuA (A:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebuB (B:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebuC (C:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ebuD (D:)
    stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
    alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
    sdlatwkalfsnkptngfvyheatvgaglpiisflreiiqtgdevekiegifsgtlsyif
    nefstsqandvkfsdvvkvakklgytepdprddlngldvarkvtivgrisgvevesptsf
    pvqslipkplesvksadefleklsdydkdltqlkkeaatenkvlrfigkvdvatksvsvg
    iekydyshpfaslkgsdnvisiktkrytnpvviqgagagaavtaagvlgdvikiaqrl