Lineage for d1ebfb2 (1ebf B:151-340)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135156Family d.81.1.2: Homoserine dehydrogenase-like [55363] (2 proteins)
  6. 135157Protein Homoserine dehydrogenase [55364] (1 species)
  7. 135158Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55365] (2 PDB entries)
  8. 135160Domain d1ebfb2: 1ebf B:151-340 [39949]
    Other proteins in same PDB: d1ebfa1, d1ebfb1

Details for d1ebfb2

PDB Entry: 1ebf (more details), 2.3 Å

PDB Description: homoserine dehydrogenase from s. cerevisiae complex with nad+

SCOP Domain Sequences for d1ebfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebfb2 d.81.1.2 (B:151-340) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
piisflreiiqtgdevekiegifsgtlsyifnefstsqandvkfsdvvkvakklgytepd
prddlngldvarkvtivgrisgvevesptsfpvqslipkplesvksadefleklsdydkd
ltqlkkeaatenkvlrfigkvdvatksvsvgiekydyshpfaslkgsdnvisiktkrytn
pvviqgagag

SCOP Domain Coordinates for d1ebfb2:

Click to download the PDB-style file with coordinates for d1ebfb2.
(The format of our PDB-style files is described here.)

Timeline for d1ebfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebfb1