SCOPe 2.08: Domain d7l1vh1: 7l1v H:1-120

Lineage for d7l1vh1 (7l1v H:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7l1vh1: 7l1v H:1-120 [399449]
   Other proteins in same PDB: d7l1vb_, d7l1vc_, d7l1vr_
   automated match to d5i4fa1
   complexed with xgd

Details for d7l1vh1

PDB Entry: 7l1v, 3 Å

PDB Description: orexin receptor 2 (ox2r) in complex with g protein and small-molecule agonist compound 1

PDB Compounds: (H:) single-chain antibody Fv fragment (svFv16)

SCOPe Domain Sequences for d7l1vh1:

Sequence; same for both SEQRES and ATOM records:

>d7l1vh1 b.1.1.0 (H:1-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvqlvesggglvqpggsrklscsasgfafssfgmhwvrqapekglewvayissgsgtiyy
adtvkgrftisrddpkntlflqmtslrsedtamyycvrsiyyygsspfdfwgqgttltvs

Timeline for d7l1vh1:

• d7l1vh1 first appeared in SCOPe 2.07