Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) |
Family d.81.1.1: GAPDH-like [55348] (2 proteins) |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species) |
Species Lobster (Palinurus versicolor) [55359] (3 PDB entries) |
Domain d1szjr2: 1szj R:149-312 [39940] Other proteins in same PDB: d1szjg1, d1szjr1 |
PDB Entry: 1szj (more details), 2 Å
SCOP Domain Sequences for d1szjr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1szjr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)} cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd
Timeline for d1szjr2: