Lineage for d1szjr2 (1szj R:149-312)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135040Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 135048Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (12 species)
  7. 135130Species Lobster (Palinurus versicolor) [55359] (3 PDB entries)
  8. 135136Domain d1szjr2: 1szj R:149-312 [39940]
    Other proteins in same PDB: d1szjg1, d1szjr1

Details for d1szjr2

PDB Entry: 1szj (more details), 2 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate-dehydrogenase from palinurus versicolor refined 2.0 angstrom resolution

SCOP Domain Sequences for d1szjr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szjr2 d.81.1.1 (R:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamkaasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1szjr2:

Click to download the PDB-style file with coordinates for d1szjr2.
(The format of our PDB-style files is described here.)

Timeline for d1szjr2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szjr1