Lineage for d1gyqc2 (1gyq C:166-334)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 506901Family d.81.1.1: GAPDH-like [55348] (4 proteins)
    has many additional secondary structures
  6. 506941Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 507011Species Leishmania mexicana [TaxId:5665] [55357] (5 PDB entries)
  8. 507034Domain d1gyqc2: 1gyq C:166-334 [39929]
    Other proteins in same PDB: d1gyqa1, d1gyqb1, d1gyqc1, d1gyqd1

Details for d1gyqc2

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad

SCOP Domain Sequences for d1gyqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqc2 d.81.1.1 (C:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1gyqc2:

Click to download the PDB-style file with coordinates for d1gyqc2.
(The format of our PDB-style files is described here.)

Timeline for d1gyqc2: