Lineage for d1gyqc2 (1gyq C:166-334)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33775Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 33776Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 33777Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 33783Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (11 species)
  7. 33825Species Leishmania mexicana [TaxId:5665] [55357] (3 PDB entries)
  8. 33836Domain d1gyqc2: 1gyq C:166-334 [39929]
    Other proteins in same PDB: d1gyqa1, d1gyqb1, d1gyqc1, d1gyqd1

Details for d1gyqc2

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad

SCOP Domain Sequences for d1gyqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqc2 d.81.1.1 (C:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1gyqc2:

Click to download the PDB-style file with coordinates for d1gyqc2.
(The format of our PDB-style files is described here.)

Timeline for d1gyqc2: