Lineage for d1ggab2 (1gga B:165-333)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866363Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 866417Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 866633Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [55356] (1 PDB entry)
  8. 866635Domain d1ggab2: 1gga B:165-333 [39918]
    Other proteins in same PDB: d1ggaa1, d1ggab1, d1ggao1, d1ggap1, d1ggaq1, d1ggar1
    complexed with nad, so4

Details for d1ggab2

PDB Entry: 1gga (more details), 3.2 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
PDB Compounds: (B:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1ggab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggab2 d.81.1.1 (B:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome [TaxId: 5702]}
cttnclaplvhvlvkegfgistglmttvhsytatqktvdgvsvkdwrggraaalniipst
tgaakavgmvipstqgkltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktym
knilgytdeelvsadfisdsrssiydskatlqnnlpnerrffkivswyd

SCOP Domain Coordinates for d1ggab2:

Click to download the PDB-style file with coordinates for d1ggab2.
(The format of our PDB-style files is described here.)

Timeline for d1ggab2: