PDB entry 1gga

View 1gga on RCSB PDB site
Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
Class: oxidoreductase(aldehyde(d)-nad+(a))
Keywords: oxidoreductase(aldehyde(d)-nad+(a))
Deposited on 1991-10-11, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.176
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: TRYPANOSOMA BRUCEI BRUCEI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ggaa1, d1ggaa2
  • Chain 'B':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: TRYPANOSOMA BRUCEI BRUCEI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ggab1, d1ggab2
  • Chain 'O':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: TRYPANOSOMA BRUCEI BRUCEI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ggao1, d1ggao2
  • Chain 'P':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: TRYPANOSOMA BRUCEI BRUCEI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ggap1, d1ggap2
  • Chain 'Q':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: TRYPANOSOMA BRUCEI BRUCEI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ggaq1, d1ggaq2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: TRYPANOSOMA BRUCEI BRUCEI
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ggar1, d1ggar2
  • Heterogens: SO4, NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaA (A:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaB (B:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaO (O:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaP (P:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaQ (Q:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ggaR (R:)
    tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
    svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
    ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnascttnclaplvhvlvke
    gfgistglmttvhsytatqktvdgvsvkdwrggraaalniipsttgaakavgmvipstqg
    kltgmafrvptadvsvvdltfiatrdtsikeidaalkrasktymknilgytdeelvsadf
    isdsrssiydskatlqnnlpnerrffkivswydnewgyshrvvdlvrhmaardraakl