SCOPe 2.08: Domain d1cf2o2: 1cf2 O:139-303

Lineage for d1cf2o2 (1cf2 O:139-303)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)

7. Species Methanothermus fervidus [TaxId:2180] [55355] (1 PDB entry)

8. Domain d1cf2o2: 1cf2 O:139-303 [39909]
   Other proteins in same PDB: d1cf2o1, d1cf2p1, d1cf2q1, d1cf2r1
   complexed with nap, so4

Details for d1cf2o2

PDB Entry: 1cf2, 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

PDB Compounds: (O:) protein (glyceraldehyde-3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1cf2o2:

Sequence; same for both SEQRES and ATOM records:

>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus [TaxId: 2180]}
scnttglcrtlkplhdsfgikkvravivrrgadpaqvskgpinaiipnppklpshhgpdv
ktvldinidtmavivpttlmhqhnvmveveetptvddiidvfedtprvilisaedgltst
aeimeyakelgrsrndlfeipvwresitvvdneiyymqavhqesd

Timeline for d1cf2o2:

• d1cf2o2 first appeared (with stable ids) in SCOP 1.55
  
• d1cf2o2 appears in SCOPe 2.07