Lineage for d1hdgq2 (1hdg Q:149-312)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527133Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2527224Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2527399Species Thermotoga maritima [TaxId:2336] [55353] (1 PDB entry)
  8. 2527401Domain d1hdgq2: 1hdg Q:149-312 [39906]
    Other proteins in same PDB: d1hdgo1, d1hdgq1
    complexed with nad, so4

Details for d1hdgq2

PDB Entry: 1hdg (more details), 2.5 Å

PDB Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution
PDB Compounds: (Q:) holo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1hdgq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdgq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]}
cttnsiapivkvlhekfgivsgmlttvhsytndqrvldlphkdlrraraaavniiptttg
aakavalvvpevkgkldgmairvptpdgsitdltvlvekettveevnavmkeategrlkg
iigyndepivssdiigttfsgifdatitnviggklvkvaswyd

SCOPe Domain Coordinates for d1hdgq2:

Click to download the PDB-style file with coordinates for d1hdgq2.
(The format of our PDB-style files is described here.)

Timeline for d1hdgq2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdgq1