SCOPe 2.08: Domain d7dc8c1: 7dc8 C:117-214

Lineage for d7dc8c1 (7dc8 C:117-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries)

8. Domain d7dc8c1: 7dc8 C:117-214 [398805]
   Other proteins in same PDB: d7dc8a1, d7dc8a2, d7dc8b_, d7dc8d1, d7dc8d2, d7dc8e_
   automated match to d1n26a2
   complexed with atp, so4

Details for d7dc8c1

PDB Entry: 7dc8, 2.76 Å

PDB Description: crystal structure of switch ab fab and hil6r in complex with atp

PDB Compounds: (C:) Interleukin-6 receptor subunit alpha

SCOPe Domain Sequences for d7dc8c1:

Sequence, based on SEQRES records:

>d7dc8c1 b.1.2.1 (C:117-214) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
pqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqkfsc
qlavpegdssfyivsmsvassvgskfsktqtfqgcgil

Sequence, based on observed residues (ATOM records):

>d7dc8c1 b.1.2.1 (C:117-214) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
pqlscfrksplsnvvcewgtkavllvrkfqnspaedfqepcqysqesqkfscqlavpegd
ssfyivsmsvkfsktqtfqgcgil

Timeline for d7dc8c1:

• d7dc8c1 first appeared in SCOPe 2.07