Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.0: automated matches [328522] (1 protein) not a true family |
Protein automated matches [328523] (5 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [398722] (5 PDB entries) |
Domain d7d2pb_: 7d2p B: [398756] automated match to d5ck9a_ |
PDB Entry: 7d2p (more details), 2.07 Å
SCOPe Domain Sequences for d7d2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7d2pb_ b.34.6.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]} dyvpdaghlvwlnftpqagheqggrrpalvlspaayngvtglmqacpvtsrakgypfevt lpahlgvsgvvladhcrsldwrsrraeqlaeapadvlaevrgklgsllgms
Timeline for d7d2pb_: