Lineage for d7d2pb_ (7d2p B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784382Family b.34.6.0: automated matches [328522] (1 protein)
    not a true family
  6. 2784383Protein automated matches [328523] (5 species)
    not a true protein
  7. 2784386Species Deinococcus radiodurans [TaxId:1299] [398722] (5 PDB entries)
  8. 2784402Domain d7d2pb_: 7d2p B: [398756]
    automated match to d5ck9a_

Details for d7d2pb_

PDB Entry: 7d2p (more details), 2.07 Å

PDB Description: crystal structure of maze-mazf (form-ii) from deinococcus radiodurans
PDB Compounds: (B:) Endoribonuclease MazF

SCOPe Domain Sequences for d7d2pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d2pb_ b.34.6.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
dyvpdaghlvwlnftpqagheqggrrpalvlspaayngvtglmqacpvtsrakgypfevt
lpahlgvsgvvladhcrsldwrsrraeqlaeapadvlaevrgklgsllgms

SCOPe Domain Coordinates for d7d2pb_:

Click to download the PDB-style file with coordinates for d7d2pb_.
(The format of our PDB-style files is described here.)

Timeline for d7d2pb_: