Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries) |
Domain d7cmuc_: 7cmu C: [398692] Other proteins in same PDB: d7cmub_, d7cmue1, d7cmue2 automated match to d2trcg_ complexed with g6l |
PDB Entry: 7cmu (more details), 3 Å
SCOPe Domain Sequences for d7cmuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cmuc_ a.137.3.1 (C:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrek
Timeline for d7cmuc_: