Lineage for d7brsa2 (7brs A:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763201Domain d7brsa2: 7brs A:220-333 [398508]
    Other proteins in same PDB: d7brsa1, d7brsa3, d7brsa5, d7brsb1, d7brsb3, d7brsb5, d7brsc1, d7brsc3, d7brsc5, d7brsd1, d7brsd3, d7brsd5
    automated match to d1jz8a1
    complexed with dms, f4x, gol, mg, na

Details for d7brsa2

PDB Entry: 7brs (more details), 2.67 Å

PDB Description: e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d7brsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7brsa2 b.1.4.0 (A:220-333) automated matches {Escherichia coli [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d7brsa2:

Click to download the PDB-style file with coordinates for d7brsa2.
(The format of our PDB-style files is described here.)

Timeline for d7brsa2: