![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.2: 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) [55336] (1 protein) automatically mapped to Pfam PF02962 |
![]() | Protein 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) [55337] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55338] (1 PDB entry) |
![]() | Domain d1otgb_: 1otg B: [39832] complexed with so4 |
PDB Entry: 1otg (more details), 2.1 Å
SCOPe Domain Sequences for d1otgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otgb_ d.80.1.2 (B:) 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) {Escherichia coli [TaxId: 562]} phfivecsdnireeadlpglfakvnptlaatgifplagirsrvhwvdtwqmadgqhdyaf vhmtlkigagrslesrqqagemlfelikthfaalmesrllalsfeieelhptlnfkqnnv halfk
Timeline for d1otgb_: