Lineage for d7av2a2 (7av2 A:209-460)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964698Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2964784Protein automated matches [269605] (1 species)
    not a true protein
  7. 2964785Species Human (Homo sapiens) [TaxId:9606] [269606] (8 PDB entries)
  8. 2964789Domain d7av2a2: 7av2 A:209-460 [398291]
    Other proteins in same PDB: d7av2a1, d7av2a3
    automated match to d3u9wa2
    complexed with act, imd, rzn, yb, zn

Details for d7av2a2

PDB Entry: 7av2 (more details), 1.95 Å

PDB Description: lta4 hydrolase in complex with fragment1
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d7av2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7av2a2 d.92.1.13 (A:209-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d7av2a2:

Click to download the PDB-style file with coordinates for d7av2a2.
(The format of our PDB-style files is described here.)

Timeline for d7av2a2: