Lineage for d7a8ma1 (7a8m A:3-237)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein Green fluorescent protein, GFP [54513] (5 species) Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
Uniprot P42212
Domain d7a8ma1: 7a8m A:3-237 [398165]
Other proteins in same PDB: d7a8ma2
automated match to d3srya_
Details for d7a8ma1
PDB Entry: 7a8m (more details), 1.6 Å
PDB Description: rsgreen0.7-k206a-n205g in the green-on state
PDB Compounds: (A:) Green fluorescent proteinSCOPe Domain Sequences for d7a8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a8ma1 d.22.1.1 (A:3-237) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvlcfarypdhmkqhdffksampegyvqertisfkddgyyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnshnayitadkqkngiksnfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstqgalskdpnekrdhmvllefvtaagitlgmdely
SCOPe Domain Coordinates for d7a8ma1:
Click to download the PDB-style file with coordinates for d7a8ma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7a8ma1:
- d7a8ma1 is new in SCOPe 2.07-stable
- d7a8ma1 appears in the current release, SCOPe 2.08
View in 3D
