Lineage for d1dt9a2 (1dt9 A:277-422)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134814Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 134894Superfamily d.79.3: L30e-like [55315] (2 families) (S)
  5. 134914Family d.79.3.2: C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55323] (1 protein)
  6. 134915Protein C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 [55324] (1 species)
  7. 134916Species Human (Homo sapiens) [TaxId:9606] [55325] (1 PDB entry)
  8. 134917Domain d1dt9a2: 1dt9 A:277-422 [39815]
    Other proteins in same PDB: d1dt9a1, d1dt9a3

Details for d1dt9a2

PDB Entry: 1dt9 (more details), 2.7 Å

PDB Description: the crystal structure of human eukaryotic release factor erf1-mechanism of stop codon recognition and peptidyl-trna hydrolysis

SCOP Domain Sequences for d1dt9a2:

Sequence, based on SEQRES records: (download)

>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens)}
nvkfiqekkligryfdeisqdtgkycfgvedtlkalemgaveilivyenldimryvlhcq
gteeekilyltpeqekdkshftdketgqeheliesmpllewfannykkfgatleivtdks
qegsqfvkgfggiggilryrvdfqgm

Sequence, based on observed residues (ATOM records): (download)

>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens)}
nvkfiqekkligryfdeisqdtgkycfgvedtlkalemgaveilivyenldimryvlily
ltpeqekdkshftesmpllewfannykkfgatleivtdksqegsqfvkgfggiggilryr
vdfqgm

SCOP Domain Coordinates for d1dt9a2:

Click to download the PDB-style file with coordinates for d1dt9a2.
(The format of our PDB-style files is described here.)

Timeline for d1dt9a2: