SCOPe 2.07: Domain d6zjao2: 6zja O:106-238

Lineage for d6zjao2 (6zja O:106-238)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
Protein automated matches [192998] (2 species)
not a true protein
Species Helicobacter pylori [TaxId:210] [397956] (2 PDB entries)

Domain d6zjao2: 6zja O:106-238 [398085]
Other proteins in same PDB: d6zjaa1, d6zjac1, d6zjae1, d6zjag1, d6zjai1, d6zjak1, d6zjam1, d6zjao1, d6zjaq1, d6zjas1, d6zjau1, d6zjaw1
automated match to d1e9ya1
complexed with djm, ni

Details for d6zjao2

PDB Entry: 6zja (more details), 2 Å

PDB Description: helicobacter pylori urease with inhibitor bound in the active site

PDB Compounds: (O:) urease subunit alpha

SCOPe Domain Sequences for d6zjao2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zjao2 b.85.3.1 (O:106-238) automated matches {Helicobacter pylori [TaxId: 210]}
lvpgelflkneditinegkkavsvkvknvgdrpvqigshfhffevnrcldfdrektfgkr
ldiasgtavrfepgeeksvelidiggnrrifgfnalvdrqadneskkialhrakergfhg
tksddnyvktike

SCOPe Domain Coordinates for d6zjao2:

Click to download the PDB-style file with coordinates for d6zjao2.
(The format of our PDB-style files is described here.)

Timeline for d6zjao2: