SCOPe 2.08: Domain d6vspb1: 6vsp B:2-250

Lineage for d6vspb1 (6vsp B:2-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [348247] (5 PDB entries)

8. Domain d6vspb1: 6vsp B:2-250 [398065]
   Other proteins in same PDB: d6vspa2, d6vspb2
   automated match to d3i3of_
   complexed with adp, edo, gol, na, nad; mutant

Details for d6vspb1

PDB Entry: 6vsp, 1.9 Å

PDB Description: structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a

PDB Compounds: (B:) 2,3-butanediol dehydrogenase

SCOPe Domain Sequences for d6vspb1:

Sequence; same for both SEQRES and ATOM records:

>d6vspb1 c.2.1.0 (B:2-250) automated matches {Serratia marcescens [TaxId: 615]}
rfdnkvvvitgagngmgeaaarrfsaegaivvladwakeavdkvaaslpkgramavhidv
sdhvavekmmnevaeklgridvllnnagvhvagsvletsiddwrriagvdidgvvfcskf
alphllktkgcivntasvsglggdwgaayycaakgavvnltramaldhggdgvrinsvcp
slvktnmtngwpqeirdkfnerialgraaepeevaavmaflasddasfinganipvdgga
tasdgapki

Timeline for d6vspb1:

• d6vspb1 first appeared in SCOPe 2.07