Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Chaetomium thermophilum [TaxId:759272] [226535] (6 PDB entries) |
Domain d6zq4g1: 6zq4 G:67-325 [397978] Other proteins in same PDB: d6zq4a3, d6zq4b3, d6zq4c3, d6zq4d3, d6zq4e3, d6zq4f3, d6zq4g3, d6zq4h3 automated match to d1glfo1 complexed with gol, po4 |
PDB Entry: 6zq4 (more details), 2.02 Å
SCOPe Domain Sequences for d6zq4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zq4g1 c.55.1.0 (G:67-325) automated matches {Chaetomium thermophilum [TaxId: 759272]} fvgsidqgttssrflifngegnpvashqiefenlypksgwheqdpyellnsvqqcidgam hkfaslgyskeniraigitnqrettvvwdsvtgeplhnaivwpdtrtsalvrelkarqsa dsllelcglplstypssvkllwliqnvdavkqayeegrlafgtvdswliyklnggaqaer pihvtdstnasrtmfmnlrtlqyddkllgffgidrnkiklpkivpssdpeafgkvatgal agvpiagclgdqssalvgq
Timeline for d6zq4g1: