SCOPe 2.08: Domain d6zjak1: 6zja K:1-105

Lineage for d6zjak1 (6zja K:1-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein automated matches [279671] (2 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [397954] (2 PDB entries)

8. Domain d6zjak1: 6zja K:1-105 [397965]
   Other proteins in same PDB: d6zjaa2, d6zjac2, d6zjae2, d6zjag2, d6zjai2, d6zjak2, d6zjam2, d6zjao2, d6zjaq2, d6zjas2, d6zjau2, d6zjaw2
   automated match to d1e9ya2
   complexed with djm, ni

Details for d6zjak1

PDB Entry: 6zja, 2 Å

PDB Description: helicobacter pylori urease with inhibitor bound in the active site

PDB Compounds: (K:) urease subunit alpha

SCOPe Domain Sequences for d6zjak1:

Sequence; same for both SEQRES and ATOM records:

>d6zjak1 d.8.1.1 (K:1-105) automated matches {Helicobacter pylori [TaxId: 210]}
mkltpkeldklmlhyagelarkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

Timeline for d6zjak1:

• d6zjak1 first appeared in SCOPe 2.07