Lineage for d6zjak1 (6zja K:1-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928869Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2928918Protein automated matches [279671] (2 species)
    not a true protein
  7. 2928919Species Helicobacter pylori [TaxId:210] [397954] (2 PDB entries)
  8. 2928925Domain d6zjak1: 6zja K:1-105 [397965]
    Other proteins in same PDB: d6zjaa2, d6zjac2, d6zjae2, d6zjag2, d6zjai2, d6zjak2, d6zjam2, d6zjao2, d6zjaq2, d6zjas2, d6zjau2, d6zjaw2
    automated match to d1e9ya2
    complexed with djm, ni

Details for d6zjak1

PDB Entry: 6zja (more details), 2 Å

PDB Description: helicobacter pylori urease with inhibitor bound in the active site
PDB Compounds: (K:) urease subunit alpha

SCOPe Domain Sequences for d6zjak1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zjak1 d.8.1.1 (K:1-105) automated matches {Helicobacter pylori [TaxId: 210]}
mkltpkeldklmlhyagelarkrkekgiklnyveavalisahimeearagkktaaelmqe
grtllkpddvmdgvasmihevgieamfpdgtklvtvhtpieangk

SCOPe Domain Coordinates for d6zjak1:

Click to download the PDB-style file with coordinates for d6zjak1.
(The format of our PDB-style files is described here.)

Timeline for d6zjak1: