SCOPe 2.07: Domain d6ye3e2: 6ye3 E:115-219

Lineage for d6ye3e2 (6ye3 E:115-219)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d6ye3e2: 6ye3 E:115-219 [397923]
Other proteins in same PDB: d6ye3b1, d6ye3c_, d6ye3e1, d6ye3f_, d6ye3h1, d6ye3i_
automated match to d2fd6l2

Details for d6ye3e2

PDB Entry: 6ye3 (more details), 2.89 Å

PDB Description: il-2 in complex with a fab fragment from ufka-20

PDB Compounds: (E:) Chains: B,E,H

SCOPe Domain Sequences for d6ye3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ye3e2 b.1.1.2 (E:115-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d6ye3e2:

Click to download the PDB-style file with coordinates for d6ye3e2.
(The format of our PDB-style files is described here.)

Timeline for d6ye3e2: