Lineage for d1bdfb1 (1bdf B:1-52,B:179-235)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134642Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 134714Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
  5. 134715Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 134716Protein RNA polymerase alpha [55259] (2 species)
  7. 134717Species Escherichia coli [TaxId:562] [55260] (1 PDB entry)
  8. 134719Domain d1bdfb1: 1bdf B:1-52,B:179-235 [39728]
    Other proteins in same PDB: d1bdfa2, d1bdfb2, d1bdfc2, d1bdfd2

Details for d1bdfb1

PDB Entry: 1bdf (more details), 2.5 Å

PDB Description: structure of escherichia coli rna polymerase alpha subunit n-terminal domain

SCOP Domain Sequences for d1bdfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdfb1 d.74.3.1 (B:1-52,B:179-235) RNA polymerase alpha {Escherichia coli}
mqgsvteflkprlvdieqvssthakvtleplergfghtlgnalraillssmpXpveriay
nveaarveqrtdldklviemetngtidpeeairraatilaeqleafvdlr

SCOP Domain Coordinates for d1bdfb1:

Click to download the PDB-style file with coordinates for d1bdfb1.
(The format of our PDB-style files is described here.)

Timeline for d1bdfb1: