SCOP 1.61: Domain d1b4ba_: 1b4b A:

Lineage for d1b4ba_ (1b4b A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (1 family)

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55256] (2 PDB entries)

8. Domain d1b4ba_: 1b4b A: [39718]

Details for d1b4ba_

PDB Entry: 1b4b, 2.2 Å

PDB Description: structure of the oligomerization domain of the arginine repressor from bacillus stearothermophilus

SCOP Domain Sequences for d1b4ba_:

Sequence; same for both SEQRES and ATOM records:

>d1b4ba_ d.74.2.1 (A:) C-terminal domain of arginine repressor {Bacillus stearothermophilus}
alvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgticgddtcliicrtpkda
kkvsnqllsml

Timeline for d1b4ba_:

• d1b4ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4ba_ appears in SCOP 1.59
  
• d1b4ba_ appears in SCOP 1.63
  
• d1b4ba_ appears in the current release, SCOPe 2.08