SCOPe 2.07: Domain d7ky3a1: 7ky3 A:4-168

Lineage for d7ky3a1 (7ky3 A:4-168)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [332591] (3 PDB entries)

8. Domain d7ky3a1: 7ky3 A:4-168 [397179]
   Other proteins in same PDB: d7ky3a2, d7ky3b2, d7ky3c2
   automated match to d4mhdc_
   complexed with spm

Details for d7ky3a1

PDB Entry: 7ky3, 2.7 Å

PDB Description: speg spermidine n-acetyltransferase from staphylococcus aureus in complex with spermine

PDB Compounds: (A:) Diamine N-acetyltransferase

SCOPe Domain Sequences for d7ky3a1:

Sequence; same for both SEQRES and ATOM records:

>d7ky3a1 d.108.1.0 (A:4-168) automated matches {Staphylococcus aureus [TaxId: 1280]}
mklraleysdllfvhelnneysimsywfeepyesltelqhlfdkhlldeserrfiveden
qvvgivelveinyihrnceiqiiikpefsgkgyakfafekaiiyafnilnmhkiylyvda
dnkkaihiyesegfktegllkeqfytkgkykdayfmsllkseyil

Timeline for d7ky3a1:

• d7ky3a1 is new in SCOPe 2.07-stable
  
• d7ky3a1 appears in the current release, SCOPe 2.08