Lineage for d1xxbc_ (1xxb C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913462Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1913525Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 1913526Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
    automatically mapped to Pfam PF02863
  6. 1913527Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 1913548Species Escherichia coli [TaxId:562] [55255] (3 PDB entries)
  8. 1913557Domain d1xxbc_: 1xxb C: [39708]
    protein/DNA complex; complexed with arg

Details for d1xxbc_

PDB Entry: 1xxb (more details), 2.6 Å

PDB Description: c-terminal domain of escherichia coli arginine repressor/ l-arginine complex
PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d1xxbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxbc_ d.74.2.1 (C:) C-terminal domain of arginine repressor {Escherichia coli [TaxId: 562]}
plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
vkdlyeailelf

SCOPe Domain Coordinates for d1xxbc_:

Click to download the PDB-style file with coordinates for d1xxbc_.
(The format of our PDB-style files is described here.)

Timeline for d1xxbc_: