SCOPe 2.08: Domain d1xxbc_: 1xxb C:

Lineage for d1xxbc_ (1xxb C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
   automatically mapped to Pfam PF02863

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Escherichia coli [TaxId:562] [55255] (3 PDB entries)

8. Domain d1xxbc_: 1xxb C: [39708]
   protein/DNA complex; complexed with arg

Details for d1xxbc_

PDB Entry: 1xxb, 2.6 Å

PDB Description: c-terminal domain of escherichia coli arginine repressor/ l-arginine complex

PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d1xxbc_:

Sequence; same for both SEQRES and ATOM records:

>d1xxbc_ d.74.2.1 (C:) C-terminal domain of arginine repressor {Escherichia coli [TaxId: 562]}
plknlvldidyndavvvihtspgaaqliarlldslgkaegilgtiagddtifttpangft
vkdlyeailelf

Timeline for d1xxbc_:

• d1xxbc_ first appeared (with stable ids) in SCOP 1.55
  
• d1xxbc_ appears in SCOPe 2.07