![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.1: PCD-like [55248] (2 families) ![]() has additional alpha helix at the N-terminus |
![]() | Family d.74.1.1: PCD-like [55249] (3 proteins) Pfam PF01329 |
![]() | Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries) |
![]() | Domain d1dchh_: 1dch H: [39699] complexed with so4 |
PDB Entry: 1dch (more details), 3 Å
SCOPe Domain Sequences for d1dchh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dchh_ d.74.1.1 (H:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Norway rat (Rattus norvegicus) [TaxId: 10116]} hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe wfnvynkvhitlsthecaglserdinlasfieqvavsmt
Timeline for d1dchh_: