Lineage for d1dcha_ (1dch A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. Domain d1dcha_: 1dch A: [39692]
    complexed with so4

Details for d1dcha_

PDB Entry: 1dch (more details), 3 Å

PDB Description: crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator
PDB Compounds: (A:) dcoh (dimerization cofactor of hnf-1)

SCOPe Domain Sequences for d1dcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcha_ d.74.1.1 (A:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
wfnvynkvhitlsthecaglserdinlasfieqvavsmt

SCOPe Domain Coordinates for d1dcha_ are not available.

Timeline for d1dcha_:

Domains from other chains:
(mouse over for more information)
d1dchb_, d1dchc_, d1dchd_, d1dche_, d1dchf_, d1dchg_, d1dchh_