Lineage for d1dchf_ (1dch F:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193436Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 193437Superfamily d.74.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55248] (1 family) (S)
  5. 193438Family d.74.1.1: Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55249] (1 protein)
  6. 193439Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (1 species)
  7. 193440Species Rat (Rattus norvegicus) [TaxId:10116] [55251] (4 PDB entries)
  8. 193466Domain d1dchf_: 1dch F: [39697]

Details for d1dchf_

PDB Entry: 1dch (more details), 3 Å

PDB Description: crystal structure of dcoh, a bifunctional, protein-binding transcription coactivator

SCOP Domain Sequences for d1dchf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dchf_ d.74.1.1 (F:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Rat (Rattus norvegicus)}
hrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmtrvalqaekldhhpe
wfnvynkvhitlsthecaglserdinlasfieqvavsmt

SCOP Domain Coordinates for d1dchf_:

Click to download the PDB-style file with coordinates for d1dchf_.
(The format of our PDB-style files is described here.)

Timeline for d1dchf_: