Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries) synonym: blastochloris viridis |
Domain d6zhwh1: 6zhw H:1-36 [396803] Other proteins in same PDB: d6zhwc_, d6zhwh2, d6zhwl_, d6zhwm_ automated match to d1r2ch2 complexed with bcb, bpb, dga, fe, hec, hto, lda, mq7, ns5, so4 |
PDB Entry: 6zhw (more details), 2.8 Å
SCOPe Domain Sequences for d6zhwh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zhwh1 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d6zhwh1: