SCOPe 2.08: Domain d6ze8e1: 6ze8 E:22-266,E:335-386

Lineage for d6ze8e1 (6ze8 E:22-266,E:335-386)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitotriosidase [82251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82252] (11 PDB entries)

8. Domain d6ze8e1: 6ze8 E:22-266,E:335-386 [396781]
   Other proteins in same PDB: d6ze8a2, d6ze8b2, d6ze8c2, d6ze8d2, d6ze8e2, d6ze8f2
   automated match to d1lq0a1
   complexed with gol, na, qgb

Details for d6ze8e1

PDB Entry: 6ze8, 1.5 Å

PDB Description: crystal structure of human chitotriosidase-1 (hchit) catalytic domain in complex with compound oatd-01

PDB Compounds: (E:) chitotriosidase-1

SCOPe Domain Sequences for d6ze8e1:

Sequence; same for both SEQRES and ATOM records:

>d6ze8e1 c.1.8.5 (E:22-266,E:335-386) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels

Timeline for d6ze8e1:

• d6ze8e1 first appeared in SCOPe 2.07