Lineage for d6zqhb_ (6zqh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931519Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (14 PDB entries)
  8. 2931520Domain d6zqhb_: 6zqh B: [396777]
    automated match to d1otrb_
    complexed with bme, gol, pg4

Details for d6zqhb_

PDB Entry: 6zqh (more details), 2.03 Å

PDB Description: yeast uba1 in complex with ubiquitin
PDB Compounds: (B:) Ubiquitin-40S ribosomal protein S31

SCOPe Domain Sequences for d6zqhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zqhb_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d6zqhb_:

Click to download the PDB-style file with coordinates for d6zqhb_.
(The format of our PDB-style files is described here.)

Timeline for d6zqhb_: