Lineage for d6zb6c2 (6zb6 C:85-219)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326706Protein automated matches [226848] (13 species)
    not a true protein
  7. 2326851Species Lolium rigidum [TaxId:89674] [396705] (1 PDB entry)
  8. 2326854Domain d6zb6c2: 6zb6 C:85-219 [396713]
    Other proteins in same PDB: d6zb6a1, d6zb6a3, d6zb6b1, d6zb6c1, d6zb6c3, d6zb6d1, d6zb6e1, d6zb6f1
    automated match to d1axda1
    complexed with gol, gsh, gtb, na

Details for d6zb6c2

PDB Entry: 6zb6 (more details), 1.9 Å

PDB Description: crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione
PDB Compounds: (C:) glutathione transferase

SCOPe Domain Sequences for d6zb6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zb6c2 a.45.1.1 (C:85-219) automated matches {Lolium rigidum [TaxId: 89674]}
dllregnlkeaamvdvwtevdahtynpalspivyqclfnpmmrgiptdekvvaesleklk
kvlevyearlsqheylagdfvsfadlnhfpytfyfmatphaalfgsyphvkawwerimar
paikkisatmvppka

SCOPe Domain Coordinates for d6zb6c2:

Click to download the PDB-style file with coordinates for d6zb6c2.
(The format of our PDB-style files is described here.)

Timeline for d6zb6c2: