![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
![]() | Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry) |
![]() | Domain d1bxnl_: 1bxn L: [39669] Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2 complexed with po4 |
PDB Entry: 1bxn (more details), 2.7 Å
SCOP Domain Sequences for d1bxnl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxnl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]} mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt lrysiesya
Timeline for d1bxnl_: