Lineage for d1bxnl_ (1bxn L:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865007Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)
  8. 865011Domain d1bxnl_: 1bxn L: [39669]
    Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2
    complexed with po4

Details for d1bxnl_

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.
PDB Compounds: (L:) protein (ribulose bisphosphate carboxylase small chain)

SCOP Domain Sequences for d1bxnl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxnl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus [TaxId: 106590]}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

SCOP Domain Coordinates for d1bxnl_:

Click to download the PDB-style file with coordinates for d1bxnl_.
(The format of our PDB-style files is described here.)

Timeline for d1bxnl_: