Lineage for d1bxnj_ (1bxn J:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330444Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 330445Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 330446Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 330447Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 330448Species Alcaligenes eutrophus [TaxId:106590] [55245] (1 PDB entry)
  8. 330450Domain d1bxnj_: 1bxn J: [39667]
    Other proteins in same PDB: d1bxna1, d1bxna2, d1bxnc1, d1bxnc2, d1bxne1, d1bxne2, d1bxng1, d1bxng2

Details for d1bxnj_

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.

SCOP Domain Sequences for d1bxnj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxnj_ d.73.1.1 (J:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus}
mritqgtfsflpeltdeqitkqleyclnqgwavgleytddphprntywemfglpmfdlrd
aagilmeinnarntfpnhyirvtafdsthtvesvvmsfivnrpadepgfrlvrqeepgrt
lrysiesya

SCOP Domain Coordinates for d1bxnj_:

Click to download the PDB-style file with coordinates for d1bxnj_.
(The format of our PDB-style files is described here.)

Timeline for d1bxnj_: