Lineage for d1bxne1 (1bxn E:151-467)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307292Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 307293Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 307294Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 307295Species Alcaligenes eutrophus [TaxId:106590] [51655] (1 PDB entry)
  8. 307298Domain d1bxne1: 1bxn E:151-467 [29378]
    Other proteins in same PDB: d1bxna2, d1bxnc2, d1bxne2, d1bxng2, d1bxni_, d1bxnj_, d1bxnk_, d1bxnl_

Details for d1bxne1

PDB Entry: 1bxn (more details), 2.7 Å

PDB Description: the crystal structure of rubisco from alcaligenes eutrophus to 2.7 angstroms.

SCOP Domain Sequences for d1bxne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxne1 c.1.14.1 (E:151-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Alcaligenes eutrophus}
fagpstgiivererldkfgrpllgattkpklglsgrnygrvvyeglkggldfmkddenin
sqpfmhwrdrflfvmdavnkasaatgevkgsylnvtagtmeemyrraefakslgsviimv
dlivgwtciqsmsnwcrqndmilhlhraghgtytrqknhgvsfrviakwlrlagvdhmht
gtavgklegdpltvqgyynvcrdaytqtdltrglffdqdwaslrkvmpvasggihagqmh
qlihlfgddvvlqfgggtighpqgiqagatanrvaleamvlarnegrdilnegpeilrda
arwcgplraaldtwgdi

SCOP Domain Coordinates for d1bxne1:

Click to download the PDB-style file with coordinates for d1bxne1.
(The format of our PDB-style files is described here.)

Timeline for d1bxne1: