Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries) Uniprot P02954 |
Domain d6z27l_: 6z27 L: [396631] Other proteins in same PDB: d6z27h1, d6z27h2, d6z27m_ automated match to d3v3yl_ complexed with bcl, bph, edo, fe, lda, olc, po4, u10 |
PDB Entry: 6z27 (more details), 2.1 Å
SCOPe Domain Sequences for d6z27l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z27l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaitff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklp
Timeline for d6z27l_: