SCOPe 2.08: Domain d6z02h2: 6z02 H:36-250

Lineage for d6z02h2 (6z02 H:36-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d6z02h2: 6z02 H:36-250 [396606]
   Other proteins in same PDB: d6z02h1, d6z02l_, d6z02m_
   automated match to d2j8dh2
   complexed with bcl, bph, cdl, d10, d12, dio, edo, fe, hto, k, lda, mys, na, po4, spn, u10

Details for d6z02h2

PDB Entry: 6z02, 2.1 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides strain rv in surfo crystallization

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6z02h2:

Sequence; same for both SEQRES and ATOM records:

>d6z02h2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d6z02h2:

• d6z02h2 first appeared in SCOPe 2.07