Class b: All beta proteins [48724] (178 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
Protein Photosynthetic reaction centre [50348] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [50350] (87 PDB entries) Uniprot P11846 |
Domain d6z02h2: 6z02 H:36-250 [396606] Other proteins in same PDB: d6z02h1, d6z02l_, d6z02m_ automated match to d2j8dh2 complexed with bcl, bph, cdl, d10, d12, dio, edo, fe, hto, k, lda, mys, na, po4, spn, u10 |
PDB Entry: 6z02 (more details), 2.1 Å
SCOPe Domain Sequences for d6z02h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z02h2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d6z02h2: