SCOPe 2.07: Domain d6xy2l2: 6xy2 L:107-212

Lineage for d6xy2l2 (6xy2 L:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6xy2l2: 6xy2 L:107-212 [396391]
   Other proteins in same PDB: d6xy2a_, d6xy2l1
   automated match to d1dn0a2
   complexed with nag

Details for d6xy2l2

PDB Entry: 6xy2, 3.05 Å

PDB Description: crystal structure of ctla-4 complexed with the fab of hl32 antibody

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6xy2l2:

Sequence; same for both SEQRES and ATOM records:

>d6xy2l2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6xy2l2:

• d6xy2l2 is new in SCOPe 2.07-stable
  
• d6xy2l2 appears in the current release, SCOPe 2.08