Lineage for d6xp0e2 (6xp0 E:165-273)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334748Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2334769Domain d6xp0e2: 6xp0 E:165-273 [396331]
    Other proteins in same PDB: d6xp0a1, d6xp0a3, d6xp0b1, d6xp0b3, d6xp0c1, d6xp0c3, d6xp0d1, d6xp0d3, d6xp0e1
    automated match to d2izzc2
    complexed with fpk

Details for d6xp0e2

PDB Entry: 6xp0 (more details), 1.95 Å

PDB Description: structure of human pycr1 complexed with n-formyl l-proline
PDB Compounds: (E:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d6xp0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xp0e2 a.100.1.0 (E:165-273) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmad

SCOPe Domain Coordinates for d6xp0e2:

Click to download the PDB-style file with coordinates for d6xp0e2.
(The format of our PDB-style files is described here.)

Timeline for d6xp0e2: