Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (7 species) not a true protein |
Species Escherichia coli [TaxId:83333] [384333] (3 PDB entries) |
Domain d6wrfa_: 6wrf A: [396175] Other proteins in same PDB: d6wrfh_, d6wrfi_, d6wrfj_, d6wrfk_, d6wrfl_, d6wrfm1, d6wrfm2, d6wrfn_ automated match to d1um8a_ complexed with adp, ags, mg |
PDB Entry: 6wrf (more details), 3.14 Å
SCOPe Domain Sequences for d6wrfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wrfa_ c.37.1.20 (A:) automated matches {Escherichia coli [TaxId: 83333]} lptpheirnhlddyvigqeqakkvlavavynhykrlrngdtsngvelgksnilligptgs gktllaetlarlldvpftmadattlteagyvgedveniiqkllqksdydvqkaqrgivyi deidkisrksdnpsitrdvsgegvqqallkliegtvaavppqggrkhpqqeflqvdtski lficggafagldkvishrvetgsgigfgatvkaksdkasegellaqvepedlikfglipe figrlpvvatlnelseealiqilkepknaltkqyqalfnlegvdlefrdealdaiakkam arktgarglrsiveaalldtmydlpsmedvekvvidesvidgqseplliyg
Timeline for d6wrfa_: