Lineage for d6wrfa_ (6wrf A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479418Protein automated matches [190766] (7 species)
    not a true protein
  7. 2479444Species Escherichia coli [TaxId:83333] [384333] (3 PDB entries)
  8. 2479445Domain d6wrfa_: 6wrf A: [396175]
    Other proteins in same PDB: d6wrfh_, d6wrfi_, d6wrfj_, d6wrfk_, d6wrfl_, d6wrfm1, d6wrfm2, d6wrfn_
    automated match to d1um8a_
    complexed with adp, ags, mg

Details for d6wrfa_

PDB Entry: 6wrf (more details), 3.14 Å

PDB Description: clpx-clpp complex bound to gfp-ssra, recognition complex
PDB Compounds: (A:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOPe Domain Sequences for d6wrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wrfa_ c.37.1.20 (A:) automated matches {Escherichia coli [TaxId: 83333]}
lptpheirnhlddyvigqeqakkvlavavynhykrlrngdtsngvelgksnilligptgs
gktllaetlarlldvpftmadattlteagyvgedveniiqkllqksdydvqkaqrgivyi
deidkisrksdnpsitrdvsgegvqqallkliegtvaavppqggrkhpqqeflqvdtski
lficggafagldkvishrvetgsgigfgatvkaksdkasegellaqvepedlikfglipe
figrlpvvatlnelseealiqilkepknaltkqyqalfnlegvdlefrdealdaiakkam
arktgarglrsiveaalldtmydlpsmedvekvvidesvidgqseplliyg

SCOPe Domain Coordinates for d6wrfa_:

Click to download the PDB-style file with coordinates for d6wrfa_.
(The format of our PDB-style files is described here.)

Timeline for d6wrfa_: