SCOPe 2.07: Domain d6wegd1: 6weg D:4-79

Lineage for d6wegd1 (6weg D:4-79)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [232833] (3 PDB entries)

8. Domain d6wegd1: 6weg D:4-79 [396142]
   Other proteins in same PDB: d6wegc2, d6wegc3, d6wegd2, d6wegd3
   automated match to d1yy7b1
   complexed with g4p, mg

Details for d6wegd1

PDB Entry: 6weg, 2.95 Å

PDB Description: structure of ft (mgla-sspa)-ppgpp-pigr peptide complex

PDB Compounds: (D:) Stringent starvation protein A, regulator of transcription

SCOPe Domain Sequences for d6wegd1:

Sequence; same for both SEQRES and ATOM records:

>d6wegd1 c.47.1.0 (D:4-79) automated matches {Francisella tularensis [TaxId: 177416]}
vtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdysinn
rkalliyiderfpaps

Timeline for d6wegd1:

• d6wegd1 is new in SCOPe 2.07-stable
  
• d6wegd1 appears in the current release, SCOPe 2.08