Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Francisella tularensis [TaxId:177416] [232833] (3 PDB entries) |
Domain d6wegd1: 6weg D:4-79 [396142] Other proteins in same PDB: d6wegc2, d6wegc3, d6wegd2, d6wegd3 automated match to d1yy7b1 complexed with g4p, mg |
PDB Entry: 6weg (more details), 2.95 Å
SCOPe Domain Sequences for d6wegd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wegd1 c.47.1.0 (D:4-79) automated matches {Francisella tularensis [TaxId: 177416]} vtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdysinn rkalliyiderfpaps
Timeline for d6wegd1: